DPCstruct | MC40609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 118 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3S715 | 320-438 | DTISSEETEWLKKRRANTIDPMRQFLERVNIQGFNVGQYIDKHRSNTSALPNIAISFSGGGYRALLNGAGALSAFDSRTSNSTSAGH… |
| A0A0D2AIM9 | 467-588 | PAKGLSFQEEAWVRGRKSVVLDAFSAYLQRVNITGLDVPALVNAMKSHNNSGVPVISMAISGGGWLSANTGVGVLRAFDARFPDAID… |
| Q6C150 | 42-154 | None |
| A0A316YCL0 | 47-163 | None |
| A0A2V8ZRQ2 | 8-118 | None |
| A0A1E4TX49 | 81-200 | None |
| A0A2V5SWR4 | 4-123 | None |
| A0A397GWD4 | 653-777 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.