DPCstruct | MC40608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 162 ± 20 aa |
| Standard deviation of domain lengths | 20.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3CUA4 | 26-184 | AAIQVTPDSPCASLCIDSSSLDKSNPGSSTTEGADIVCADADFSNTAAGQKWTSCMSCLQTSTFAQGSESDQAWFFYNLRYNVDYCV… |
| A0A4Z1HIQ0 | 1-150 | MRSSILVPSLFLITSFTQSASELKALPGSPCASKCGNVLEGTSGENDIVCQNTDYTSLIGTTYSGCVGCQLTSTFVDPSTNETDLEW… |
| A0A2J6PL88 | 16-147 | None |
| W2S1Y0 | 21-173 | None |
| A0A6A5QXS2 | 35-219 | None |
| A0A4Q4VAJ5 | 3-172 | None |
| A0A2N6NNA9 | 1-113 | None |
| A0A0G4KGA7 | 1-166 | None |
| A0A0P7BLA6 | 13-157 | None |
| A0A3N2PXF0 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.