DPCstruct | MC40607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 113 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A756JSC0 | 10-122 | NPYFWLMAALFLVLLFGAIEPAHAADATEGGGSGLPWEGPLTKLKQSISGPVAFVIALLGIIACGATLIWGGEVSEFTRRIIYVVLV… |
| A0A522DY63 | 4-111 | NKNQNLALFMVLTITFLAPEQAYATGTAGGLPYESWLTNLQNSVTGPVAFGLSIIGIVVAGGVLIFGGDLNGFFRTLIFIVLVMALL… |
| A0A286ALD9 | 15-125 | None |
| A0A024LPM2 | 8-125 | None |
| A0A7W5Y2T1 | 2-107 | None |
| A0A317TYL9 | 6-120 | None |
| A0A7W8UG20 | 1-123 | None |
| A0A257NXM2 | 33-138 | None |
| A0A2N0V6N4 | 1-119 | None |
| A0A0L6JZ44 | 3-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.