DPCstruct | MC40606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 206 ± 38 aa |
| Standard deviation of domain lengths | 37.63 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19952 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9ZWK3 | 1-189 | MKENPDPRGLSRGEIVRIEGNVYPMSLLKFEMAIGAFSEFTGDDIQEAFHAIDQPTPFTKDEERQMEAVGTLMESFTGDMYPLRIES… |
| A0A3S8RNI0 | 1-198 | MVQTIASMLSIVIDELASNDYISKISVSEAGSFINIPVEFRINSFRHLMNEVDNFMDLYNLIENMNNHSKAKNKKNKEFDQVKTIID… |
| A7NQ90 | 1-165 | None |
| A0A2A3Y0X2 | 2-163 | None |
| C3PHQ7 | 152-365 | None |
| A0A2H5A485 | 1-166 | None |
| A0A0D0J8M4 | 101-314 | None |
| A0A173WLI4 | 9-298 | None |
| A0A164PBS4 | 29-268 | None |
| A0A3N0ATN4 | 9-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.