DPCstruct | MC40602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 245 |
|---|---|
| Mean domain length (aa) | 150 ± 32 aa |
| Standard deviation of domain lengths | 32.37 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.80 |
| Pfam Score | 65.89 |
| Assigned Pfam label(s) | PF02563- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4ZYY2 | 16-162 | RKGTIRLVYITGDVPIVGLTAKEAEAFISKQYYEHRIYRKAHVLLKITKYSAKEVMVTGKFAQTGPFVFPPEVEAMDILEVITRNGG… |
| A0A7R9P2Z4 | 91-246 | TVWDHPELTTPAGQYRSASDTGNWVHSDGTIFYPYIGRVRVAGRTVGEVRDEVSRRLAQYIESPQVDVSIASFKSQKTYVTGSVTTS… |
| A0A2V9LB70 | 26-182 | None |
| A0A2J0KPR9 | 87-260 | None |
| A0A849UD59 | 6-114 | None |
| A0A7C4UAP2 | 276-419 | None |
| A0A521DDF5 | 28-171 | None |
| A0A858RK32 | 11-125 | None |
| A0A7C9PWF8 | 98-248 | None |
| A0A800J658 | 5-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.