DPCstruct | MC40600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 189 |
|---|---|
| Mean domain length (aa) | 214 ± 45 aa |
| Standard deviation of domain lengths | 45.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 22.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4ZUL3 | 15-225 | TVTKEHIVMKSKNLPNHPTANFPDYERKLDGNPNYVAEQNLTFYLPLVPKKNPRPVAMDKRNTNRALPGGPIGVAANGVIFFNPFDH… |
| A0A7K0ZIQ3 | 34-224 | GFSAFSSSVKTLKSGKYYLVESNGLPPHNMMVGITNWQQQVPVPQPYSGSNAWQIPTTPKLAATPLSAKNNLFRGAIALAADGVPIF… |
| A0A2U2X9U1 | 2-219 | None |
| A0A3N4SBU1 | 229-390 | None |
| A0A349JWF5 | 559-748 | None |
| A0A6P4YX58 | 26-239 | None |
| A0A1J5T9G0 | 109-395 | None |
| A0A2E9J422 | 104-398 | None |
| A0A6U2AEM6 | 87-321 | None |
| A0A222FHV2 | 120-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.