DPCstruct | MC4060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 195 ± 22 aa |
| Standard deviation of domain lengths | 21.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816UGQ6 | 1-162 | MTSTTNNNRTREPTDRLEKIILKYIQNCTQHVRQKAENRILLVKAEMEEYKALEVFEQLATPLQWSTHLIFKSKMKLYGTKSKNYLA… |
| A0A820RSU7 | 6-195 | NNNRTREPTDRLEKIILKYIQNCTQHVRQKAENRILLVKAEMEEYKALEVFEQLATPLQWSTHLIFKSKMKLYGTKSKNYLAATKRV… |
| A0A819YQC6 | 1-194 | None |
| A0A816WSF1 | 66-253 | None |
| A0A819MHY7 | 55-248 | None |
| A0A820ZMR9 | 412-578 | None |
| A0A819KEI2 | 52-278 | None |
| A0A815ZS30 | 1-200 | None |
| A0A819IW26 | 5-197 | None |
| A0A819J070 | 81-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.