DPCstruct | MC40590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 192 ± 31 aa |
| Standard deviation of domain lengths | 31.29 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 94.51 |
| Assigned Pfam label(s) | CL0245- PF02734 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0VQW4 | 412-624 | GPRPSDPKLFLAALESALKSVIAAEPEITRYDTIAGDGDAGLTLKAGAQGILDAISENRIPDDDVVAAMVACSEVVEREMGGTSGGL… |
| F3WH81 | 4-148 | GFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQILTLEELYQMFRDGADGVISRGKAEPGDKTMC… |
| A0A811MW39 | 172-341 | None |
| F6FQ17 | 5-230 | None |
| A0A482VFX5 | 352-521 | None |
| A0A5D0PS61 | 1-198 | None |
| A0A848A030 | 5-128 | None |
| A0A377YXK9 | 5-149 | None |
| A0A7S2UN07 | 95-303 | None |
| A0A6L8NDH6 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.