DPCstruct | MC4059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XTJ8 | 331-426 | HTLDGCEVQPLGEELNPEREELLVDMDALRERGLEIINTTAYIAITGAESISVYEDVLRSVRYRLAKGSARFERRFRLSCSEMNGRY… |
| A0A820REM4 | 2-112 | NAIKKQQADISDCMLQAIPSLSNTEQLIIPDAPNLEKQVTNEGATFSGLETIDVYQSLFRQIAYVSHAPITYMDRSFALSCVSVSAR… |
| A0A814WN65 | 398-507 | None |
| A0A1L8FFI5 | 187-332 | None |
| A0A3P6TQ88 | 255-368 | None |
| A0A820NAW8 | 1-111 | None |
| A0A7R8CGZ6 | 437-537 | None |
| A0A6P3RQC5 | 129-224 | None |
| A0A7R9PPN7 | 1-103 | None |
| A0A3Q0IWU9 | 490-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.