DPCstruct | MC40589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 120 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4GEQ0 | 1-128 | MNPSHLFSAALILCLGASVSAQDSISREAWSAYMQDALPEFLCHEESYFVECFEVDIEQCKRSLSALARSCLESLAEHIPDPIRSAQ… |
| A0A1W2DW24 | 138-241 | PKITDNPWAVGMYALLPKLVCQDNQIYRQCYAVSQNECETAMKSATADCLQRYLSELPPDISTNKKIGPHWGEIVGACAIEKYISSL… |
| A0A0Q9YN99 | 48-169 | None |
| A0A3B9RXJ6 | 23-138 | None |
| A0A0W0RQJ6 | 4-128 | None |
| A0A4Q6Y560 | 1-116 | None |
| A0A522FBG8 | 57-170 | None |
| A0A1Q3SEV4 | 55-188 | None |
| A0A0U5DVM6 | 8-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.