DPCstruct | MC40583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 6.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017HIH4 | 2-123 | ATLAGNVLQRTRCHYFRDRQCAACNKRETGSGCAVLECRNRRLAVLGTSERCIANYSGDFAIALVTLRAEVTVRGTDGSERTLPFEN… |
| A0A6D0ENU5 | 40-146 | ATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAAREGYSRQLAVVGASDACIATHPSDMAVAMRVLDAKVETVDPDGKTRTFPVDEL… |
| A0A1Q9T7A9 | 88-193 | None |
| A0A5S4FJN2 | 70-170 | None |
| A0A1I3NBV5 | 111-210 | None |
| A0A535IBB5 | 134-248 | None |
| A0A2U2VGJ7 | 107-219 | None |
| A0A6F8Y475 | 1-104 | None |
| A0A377DHV4 | 59-169 | None |
| A0A2A2M394 | 70-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.