DPCstruct | MC40581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 601 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Standard deviation of domain lengths | 19.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.23 |
| Pfam Score | 97.86 |
| Assigned Pfam label(s) | CL0213- PF00057- PF01186- CL0550- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6BE83 | 25-148 | LFDVQKKGPPQEGGLRLVGGDLPNKGRVEVYHDGQWGTVCDDDWDLNEARVVCQQLGFPGAVSAIPGGTYGEGSGPIWLDNMNCKGS… |
| A0A1S3HLM0 | 91-194 | TGRIRLVNGSHSREGRIEVFYKGQWGTVCDDRFDVKDARVVCRQLGYPTAYPTVYASARFGQGTDPIWLDDLDCVGSELDIKSCANR… |
| A0A2B4SUN2 | 16-135 | None |
| A0A7S4P8Y3 | 197-320 | None |
| A0A668S800 | 21-87 | None |
| A0A6S7FTR4 | 283-389 | None |
| C3ZI36 | 733-858 | None |
| K7F578 | 260-373 | None |
| A0A6P8H0T6 | 113-238 | None |
| A0A6P8HKM8 | 73-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.