DPCstruct | MC4058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 3 aa |
| Standard deviation of domain lengths | 2.71 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267FBM7 | 20-103 | DDLVKLYPQVQEANAMSEELDRRVRFELVLMSPQGRGLRENEGRTEVYISLTNLDSGNEFFWSKDKFSDRKYLMRDMYQNYMEG |
| A0A0N4XPR8 | 1-88 | MMPLVYRANAMADELKRNVKFELVLVSPEMRGLPADGLTEIWVSVHNLAEDTRFMWEKARFMNRYYGMQEMYENKQDGEDWAMPKVSE |
| A0A0B1S133 | 2-83 | None |
| A0A1I7WJT5 | 35-114 | None |
| A0A5K3EQM3 | 163-248 | None |
| A0A1S3J029 | 81-166 | None |
| A0A183LSR4 | 123-207 | None |
| A0A7R8W8N4 | 175-259 | None |
| A0A0K0DGM2 | 144-228 | None |
| A0A2G9UIG2 | 158-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.