DPCstruct | MC40578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 857 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Standard deviation of domain lengths | 21.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 95.72 |
| Assigned Pfam label(s) | CL0228- PF03094- CL0046- CL0030- CL0487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A358D3V5 | 48-163 | AIPSVSAVGTDLEVEDLLVGDGEAVEPGDTVSVHYLGSLVDGTVFDTSWSRGRPFTTQIGVGMVIQGWDQGIIGMREGGRRLLKVPS… |
| A0A7I7KPA0 | 64-178 | RVTVTAPFSVSQTQVHTLRAGDGPVVSSTANVSVCYMGVNGRDGSVFDSSYERGAPVDFPLTGVVPGFQKAIAGQKVGSTVAVAMVP… |
| A0A0D2NVZ5 | 396-529 | None |
| A0A504X728 | 140-261 | None |
| A0A2G8L6I5 | 2-106 | None |
| A0A521FRK1 | 480-597 | None |
| K8FCB0 | 23-152 | None |
| A0A7S4E3P2 | 4-98 | None |
| A0A034VLD7 | 873-996 | None |
| A0A1Q9C363 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.