DPCstruct | MC40577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 593 ± 92 aa |
| Standard deviation of domain lengths | 92.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VNW0 | 18-569 | TLNFVFNLFIYGNMVNELPLMQINIQGYWLSSTLALKARLTSIAFMGRNEELYNSIAPLNEYINNEFNELIVENLIDLSSTDPLSKD… |
| A0A1Y1UX95 | 175-733 | LKVKMTICIILFIIVFGIQALFTIFIFDSIKKNVEMLNTNMCIPGYIKSIAFFIRNLSLNFITGKMYNYYRNNGALIGISGFLAEQN… |
| I7MHE3 | 581-1189 | None |
| A2FHK9 | 22-525 | None |
| A2FGT7 | 330-937 | None |
| A2DH95 | 146-983 | None |
| A2DFM0 | 3-431 | None |
| A0BLR3 | 422-935 | None |
| G0QL36 | 500-1159 | None |
| A0A0L0T5C9 | 680-1259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.