DPCstruct | MC4057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 218 ± 41 aa |
| Standard deviation of domain lengths | 41.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815S712 | 102-325 | CTTSNVIYALTCPCHQYDYIGRCDVSFRECIMQHRINNGRVMSNFFLGQTVADRLGNDRDEKLIISESDTKLYQHSIECLTTIKIFL… |
| A0A820QDV9 | 1-219 | TCTTSNVIYTMTCPCGHYDYVDSTAKTLSSAMIYHREHGNRRIHEKLTGTSLLRGAIFDPNENENTIANKMRLYQHSARCPIALRSF… |
| A0A815P174 | 256-474 | None |
| A0A820J2F3 | 1-196 | None |
| A0A815T5D1 | 415-641 | None |
| A0A815U5A4 | 2-167 | None |
| A0A819QLR1 | 2-233 | None |
| A0A820X899 | 245-509 | None |
| A0A815Y096 | 30-264 | None |
| A0A815B7D1 | 240-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.