DPCstruct | MC40569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 177 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UXV2 | 1-177 | MQGIIRYALSKSNLSTEIDTYQEIGNGFIRNAFFPWVFLLFFTLNRNNWKRTVNLVLIIHWILRSCGDIIFAFIPLRPYVEGHYWPF… |
| A0A1Y1X6I3 | 37-237 | FNCYLEYLNSLNEEQKIDNVIEKVRVIAYALHKPFQFLFFYWTILIIVLYKFNFKKPVMKIILGYFTLSIIGNIIEKFGDLLSFYYS… |
| A0A1Y1WSS2 | 1-183 | None |
| A0A1Y1XI82 | 53-236 | None |
| A0A1Y3MTQ0 | 1-144 | None |
| A0A1Y2CD81 | 1-180 | None |
| A0A1Y2B9Y9 | 1-153 | None |
| A0A1Y2ATH0 | 40-265 | None |
| A0A1Y1ZKZ9 | 24-185 | None |
| A0A1Y2D7I0 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.