DPCstruct | MC40567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 249 |
|---|---|
| Mean domain length (aa) | 138 ± 33 aa |
| Standard deviation of domain lengths | 32.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 32.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UHH4 | 14-145 | NGNGRCPDGFCCSKDGWCGKTESHCSILNGCQYQFGTCKGESNQEPQEQETSNGKCGKGIGKCQEGQCCNKYGYCGKTDNHCLVSHG… |
| P83790 | 2-80 | PECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQ |
| A0A179I2I0 | 166-309 | None |
| A0A6J0NWX0 | 19-171 | None |
| A0A0D2ELL4 | 12-137 | None |
| A0A317ADQ0 | 9-112 | None |
| E4URQ3 | 326-464 | None |
| A0A1Y1VM20 | 642-782 | None |
| A0A1Y1VEF2 | 145-330 | None |
| A0A1Y1VGK3 | 184-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.