DPCstruct | MC40565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4FML6 | 2-104 | ENRIIECIANYDKTSFSDLSKHVEGFDGKLALRDPNNKGVVFWNNISEEAAEVICKLIDDGKIKMIPTEIMTYMIDGLFPKMPLAKK… |
| A0A521ULE6 | 30-135 | LDIAIEHYVCRHDHVSLVELRDALEPFFTVRGDCRLDIAPNVCLWANMSQEFADAIADLERAGKVHFWPTSIMVYLADGGVLNLPLA… |
| A0A7S7QLM6 | 25-130 | None |
| A0A2W4K5P5 | 10-139 | None |
| A0A520KBV4 | 3-96 | None |
| A0A1G9J3A0 | 12-127 | None |
| F8IH43 | 38-145 | None |
| W6S0E1 | 1-94 | None |
| A0A2U3MUL4 | 90-193 | None |
| A0A2M9RWT7 | 3-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.