DPCstruct | MC40562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.12 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 60.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6WI48 | 102-173 | IAQFRGMVHGLASESRRLLTEELMFSSKAAPVPAVPWESIRDNPTDERPGWNFLKDHRTSMPVDGERWLFER |
| A0A834VV52 | 1-72 | MAQFRGMVHGLASESRRLLTEELMFSSKAAPVPAVPWESIRDNPTDERPGWNFLKDHRTNMPVNGERWLFER |
| A0A0D1YCE5 | 247-324 | None |
| A0A2W1CLA4 | 93-172 | None |
| A0A229XVH1 | 41-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.