DPCstruct | MC4056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 536 ± 43 aa |
| Standard deviation of domain lengths | 42.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 45.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820A071 | 54-641 | MNLSYLIFLNEQTPQPIKLIQQLLYDTSLIQDKHFMNFSGSNCLKYLPLIVERIDQYFKENNSTLMMDIQQWIIETIKKSKRSSDQE… |
| A0A820Q317 | 1-504 | MNLAYVILLNEDTSEPLQLVDSLLKLLHYDNNDDENRNQTTNYLKELPNIIDTINEYISNKSIIGFTLLIDVHLWIISILKKLKKRP… |
| A0A816MSL9 | 208-711 | None |
| A0A820ZG55 | 2-498 | None |
| A0A817SQ29 | 9-620 | None |
| A0A821BT85 | 10-520 | None |
| A0A819U0P7 | 378-948 | None |
| A0A815WBD7 | 1-485 | None |
| A0A818T1Q3 | 115-628 | None |
| A0A821WTB9 | 546-1116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.