DPCstruct | MC4055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 416 ± 73 aa |
| Standard deviation of domain lengths | 72.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 88.97 |
| Assigned Pfam label(s) | PF20920- PF03344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182XUT1 | 222-588 | EFQELLDACRKADSSKDMETLIERKLIRYYEIVHPDYIGSKSFKKAVTKVTAEVRATPNLVFLKLANIVEELNARRKSRSVATADEK… |
| A0A820NU38 | 2-351 | VDNIRTKFEKFVSLIGEILVGETEIHKIQNKLRRHFNATSPSYLCSRDFTSMLHHIHNVFTQNHKSTKYYSLLVSFAGQMKINSIES… |
| U5EF61 | 103-540 | None |
| A0A817CLN5 | 156-512 | None |
| A0A3M6U6H1 | 20-473 | None |
| A0A553PEH0 | 454-950 | None |
| A0A6J1P1E2 | 312-808 | None |
| A0A4Z2DJJ3 | 2-274 | None |
| A0A814W1S0 | 8-368 | None |
| A0A6P9D3S8 | 152-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.