DPCstruct | MC40543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LFJ0 | 1-101 | MGKHSHRAFKSLKQTAFRIHTHGQLYSHAAATLKIPNVDTLQPNVRKYVQEKMSLCQPDNIHICDGSEAENDMLLSLLEKEGMIKKL… |
| A0A820YIV3 | 5-91 | SVPFSEVHYLTLDKVGNVPIKKGTFQLLPSHVQAWLAQMIQLCTPRDVHICDGSEEEAETATKMLVEIGQLSPLKKYENCYICRTDP |
| A0A0B1SP31 | 1-77 | None |
| A0A1I7WNG2 | 57-166 | None |
| A0A183UVE7 | 1-112 | None |
| A0A183UQN0 | 555-654 | None |
| A0A820ZCT6 | 1-92 | None |
| G1RYX0 | 5-100 | None |
| A0A1I7XWP9 | 101-204 | None |
| A0A0M3IIB4 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.