DPCstruct | MC4054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 185 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820NI62 | 1-181 | YIRKRKTNNNDDDASNVLVTLRLLRVLVRYPQQLRTIFETNLLNLPTIARQRLIPQLFSRLNHPSSFVRDYATNLLIGIAKDFPQLI… |
| A0A2A2JZR6 | 890-1068 | TLSTTLRILELLVKESEMLSQSIVENMHTTNVHLWKDILPQLLARLSHPSTKVRAPIMLLLSRICQAAPHAIVYQIVSGASSAYAMD… |
| A0A816CGQ1 | 1-197 | None |
| A0A820MTG2 | 1-169 | None |
| A0A816MAF6 | 314-495 | None |
| A0A820RWW4 | 679-874 | None |
| A0A0M3IV55 | 7-164 | None |
| A0A821ACI8 | 14-229 | None |
| A0A2G9SG23 | 84-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.