DPCstruct | MC40533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 131 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2CYR1 | 120-231 | ELPVFVVDGKRKPKIAINDASAIARGKPWLLNTMRDKDAAELNREFAGCKAVWAGPDSCDEYPFASTYQGGLGAQVMGVPKWENDQQ… |
| A0A5P2VKK5 | 69-186 | FDVEYQIDSAKYPESAKHIAEAQKGMIWRGHSHSSGSPLPSVLTIDRGGAHQNRKDSLRGIRTNRGTQRDEYPPAMFKEGGTGASVK… |
| A0A084RXM3 | 1-170 | None |
| A0A2H3C7S4 | 31-157 | None |
| A0A0D2P6L2 | 81-191 | None |
| A0A559QJH8 | 99-225 | None |
| A0A243QPF4 | 348-477 | None |
| A0A2G7D003 | 188-331 | None |
| A0A2H4SL78 | 227-385 | None |
| A0A4U5W6D3 | 3-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.