DPCstruct | MC40531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3KIA2 | 183-284 | SGRTVAMGRNMADRVIPYAQKNGYDWYKGTPGWVPRGAIEKVSPRALERTDLWFNKRWIKGEMRNGSRIMDIGEPPGYPPSTFYNME… |
| R5WRJ1 | 1-101 | MRILKRGVVIGESMSRVDAAAKQIGALTYKAPGQNIVKILGKAKAFELNKALNKAWIKRMARWGVKIYDIGLDFTRATRSPFYAIEA… |
| A0A0D0GI06 | 117-228 | None |
| A0A2D5GTL6 | 247-333 | None |
| A0A3D5RJG8 | 52-151 | None |
| A0A7V5Y6K5 | 51-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.