DPCstruct | MC4053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 406 ± 84 aa |
| Standard deviation of domain lengths | 84.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 67.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817CJ62 | 8-323 | CLSENKCGEYGYCHLVQGEISCECKFWWEGEFCDQQSNSGKQVIILACLTAIIMVIFYSLQIIRNLYKIRKKRKENKEKEALQDTTL… |
| A0A820NAE5 | 5-444 | SNDIPLKETPVYRFWVDNNRDILAYDCGIMWLAKNTSVITPAPCVEQALRPYVCKQTIDRCHNHRSNCGKYGKCIDLPMKNSHQCQC… |
| A0A819D0P2 | 149-679 | None |
| A0A820GIT7 | 135-656 | None |
| A0A817JKH0 | 205-561 | None |
| A0A819UXC6 | 72-474 | None |
| A0A814U0J8 | 17-339 | None |
| A0A820CTI4 | 95-422 | None |
| A0A819B740 | 209-594 | None |
| A0A815EFN6 | 148-684 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.