DPCstruct | MC40522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 70.52 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0023- PF04758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369J386 | 1-48 | MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRILYNRRLEFLG |
| A0A7R8CSD4 | 111-168 | GKVHGSLARAGKVRGQTPKVEAQEKKKKKTGRAKRRIQYNRRFVNVVQSFGRRRGPNS |
| A0A5N5K7M0 | 1-58 | None |
| K3Y2S3 | 78-132 | None |
| T1FQB5 | 415-477 | None |
| A0A4Y1R4C8 | 1-62 | None |
| A0A146F7V9 | 1-56 | None |
| A0A4Y7L4R0 | 28-82 | None |
| A0A099P1X0 | 185-246 | None |
| A0A2G5DH91 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.