DPCstruct | MC40521
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18941 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4HWM3 | 5-62 | LSMEVVPAERNADMLEKVPHKNIEDMAVVYRFVLDASDEGRASILVTNQLLDSYGITA |
| A0A3D0DJ52 | 2-68 | LNFDEIKEDISLRLMNTENNQDKLQNRPHEQMEDISAAFVIVVGETKEGLATAPITNEIMDELGVDQ |
| A0A416PRI5 | 58-124 | None |
| A0A415S5G7 | 119-185 | None |
| A0A1I7IIW4 | 99-165 | None |
| A0A1G5GE30 | 98-164 | None |
| R9MEK0 | 16-82 | None |
| A0A1G6FHX4 | 99-165 | None |
| A0A6L5X2L5 | 106-172 | None |
| A0A396ALW6 | 29-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.