DPCstruct | MC40520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 393 |
|---|---|
| Mean domain length (aa) | 108 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5E950 | 9-131 | RNLCIAAFLLLNCGDAVAQVGIGTSQPDDSSILDISSTDKGLLIPRVFLTGALSNSLDGVNPSPVGLTVFNTNPNVSDGNGIGYYYW… |
| A0A1D7XZZ0 | 392-457 | TNVGIGTATPSASAKLQLDSTSQGFLPPRMTEVQRDAIISPEEGLMIYQTDATKGWYGYNGTAWIQ |
| A0A2N3A002 | 1-134 | None |
| A0A1M3DYJ2 | 6-154 | None |
| A0A376DRN3 | 3-153 | None |
| A0A1M7D7V3 | 12-135 | None |
| A0A1J0LLR3 | 3-115 | None |
| A0A2N5YYR3 | 3-84 | None |
| A0A2N5YVP3 | 9-127 | None |
| A0A2N5YQD7 | 5-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.