DPCstruct | MC40516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 13.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TU68 | 13-188 | VTRSDFDNPEVLYAINPHPEFGYFHGPIPDLNPGWKPQWYSDARASGTLNPSKSITSSDILYEIQFGNAPVNRMSQLAKACSTICDI… |
| A0A1V6T1Y9 | 3-179 | ISEFLDPQLRGHPNPHPLSGYAHAPIPNRNPDWKPDLIQVVSESTLNAPEGSPVPFTTQNVTDTLQCRRPRYPMVKVNRINSRVCDI… |
| A0A2B7WEL7 | 3-153 | None |
| A0A6G1FQU0 | 5-151 | None |
| G0S3F4 | 20-196 | None |
| A0A5M9MLR2 | 6-150 | None |
| A0A1S9RLD5 | 1-138 | None |
| S8B9Z5 | 13-171 | None |
| A0A0G4PBB7 | 6-153 | None |
| A0A1Y2DE99 | 3-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.