DPCstruct | MC40513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 108 ± 19 aa |
| Standard deviation of domain lengths | 18.51 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2V3B1 | 193-291 | VSSSSDMKFKLNTEGDPKQYSNPEGDISIAPSLVYHNNNITVFRFDNVDPDELPQIFRVLEDLTEERLKMVWLGDLVAVNGVHDVLS… |
| U4X157 | 210-303 | PVPRNYNYYQAPEKRSKHIMPSEIFDDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDK… |
| D3SGS2 | 31-132 | None |
| A0A381A4G6 | 22-126 | None |
| K2KRG8 | 5-84 | None |
| D3SGS3 | 10-116 | None |
| A0A1Q6UDE1 | 185-349 | None |
| A0A1V1PA41 | 239-356 | None |
| A0A838L1S1 | 94-195 | None |
| A0A4R0NTP8 | 56-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.