DPCstruct | MC40512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 193 ± 29 aa |
| Standard deviation of domain lengths | 29.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.72 |
| Pfam Score | 94.93 |
| Assigned Pfam label(s) | PF06119- CL0345- CL0066- CL0568 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2V2S2 | 64-258 | SNHGGMAYANISAPIITPTSVPKVEEVVGGQQVASNKSRLSAVSSVKIDVELVTSETVTFSTTNTLGGKIGGKFKGVNLEFSYSLAI… |
| E3BQM2 | 192-440 | FNYVLNPRKFFYDDMTESGRNLVKTLTAYIINDSDILKQIEVEFQFEQGVDWSKDDDFALGQHVRVNRDFRWPQIGATKFDITLPAG… |
| A0A397SQE5 | 169-392 | None |
| A0A182YTK6 | 273-447 | None |
| A0A226F614 | 323-541 | None |
| A0A2V1D3G6 | 1-147 | None |
| A0A0D8XXZ9 | 9-204 | None |
| A0A4R2RGD7 | 1-175 | None |
| A0A2G8L0F5 | 1-152 | None |
| A0A438NAB6 | 240-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.