DPCstruct | MC40509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 126 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF11016- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9DJ25 | 1-124 | YADAERLRENCATDVLKQVKTDVTRYRYGDEQHLDEALKRIFQYGQGGGIPRRSAPVLQMIREEVTGDGRYCLVLVFEAKALQLSDF… |
| A0A0G4EU95 | 74-203 | AELEPCPVRTTSEADRMFDAKATETIKKIKEDVTRHRYGDDAHLDTTVESLGLWPNPEKEPPQLQYIQQGVSPDGELEFMMVWKSET… |
| A0A0G4IB37 | 148-278 | None |
| A0A7J7L3V6 | 1-139 | None |
| A0A7R9TIJ4 | 175-306 | None |
| A0A219HZL6 | 145-259 | None |
| A0A7J8USV0 | 115-215 | None |
| A0A1R3JIR8 | 756-874 | None |
| A0A2J6M122 | 151-285 | None |
| A0A835KDT2 | 301-448 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.