DPCstruct | MC40505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 191 ± 31 aa |
| Standard deviation of domain lengths | 30.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2XWH0 | 2-124 | GRALETAALSAADKTIDQSDVAAIQAAERRATGCNETLPGGVAAEAQSAATRNSRTMLFEDKATLSDVLCDASSKLPKDKAVTGEDA… |
| A0A7C9DAG3 | 102-320 | MESAENRAFGKTIKGGPASLMRSAAAINVEAGLVGPNDASPSFARHGLVEGETWNESQPAHEQMEAVLSGPDALGVDGAGGERTIGE… |
| A0A7G2DN46 | 528-711 | None |
| A0A2T7C6M4 | 9-169 | None |
| A0A5B6VQB7 | 403-640 | None |
| A0A843WPS9 | 3-206 | None |
| A0A5B6VZT2 | 240-454 | None |
| A0A1R3KD93 | 2-149 | None |
| A0A1U8P0B3 | 64-270 | None |
| A0A5J5BKT7 | 5-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.