DPCstruct | MC40502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3FER9 | 1-137 | MKKKKCNSPSAKSKSLESVSVLTWEQVSRLNEVLTEVVPVHGRGNFPTLEVRLKDIVARVRSRLELSGIRVKDVRLNGSTASHVLVQ… |
| T1EGV6 | 4-108 | QVLCFDQVDRLNRVMDATVPIHGRGNFPTLNVRLIDFVKVVRNKLVENDVHVKDVRLNGGVASYVLGNENNQAFNDYDVIFSVQLKD… |
| A0A814PSL3 | 109-243 | None |
| A0A3Q3FLG0 | 3-119 | None |
| A0A3B3QES8 | 2-126 | None |
| T1FNH1 | 1-133 | None |
| A0A4Z2EMQ5 | 3-121 | None |
| A0A6A4VN96 | 429-527 | None |
| E4YC80 | 89-192 | None |
| A0A3M7RVN1 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.