DPCstruct | MC40500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 106 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF04917- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1GWC3 | 12-112 | LALSAGTPVLAATSKDAQPPVRYVQVSNTQSCAPDTFCTFTATCPTGTVVTGGGVSVTPFVSSGVYLYETEPSSNTSWVGTVRNASA… |
| A0A6B1PJL1 | 2-77 | GYQVVKLPNANVPNFQRRTVYCPAGKVAVGGGAEAQGADAILVGSFPTDDGRGWIALGRQNSYSSVGISVYAICVN |
| A0A7V9IFU3 | 70-192 | None |
| A0A5C5GJK8 | 1-102 | None |
| A0A2M9LDC1 | 30-141 | None |
| A0A5E9X9Y2 | 333-410 | None |
| A0A433DJQ3 | 58-183 | None |
| A0A7W0Q2E6 | 104-236 | None |
| A0A1Q4V800 | 1-83 | None |
| A0A536QQE0 | 283-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.