DPCstruct | MC405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 178 ± 14 aa |
| Standard deviation of domain lengths | 14.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G4ARJ9 | 182-373 | LDEAGVHGSLLHPFYDLVSADCLSPTARIHTRTFYNHRTYLVKHPAGMGRLQNVTQIDGKYCVFDPPDSQNLLSPSQLEQKLMHQYN… |
| A0A0D2AIZ7 | 27-212 | DQLFPFYDHARFCYGKAAQTPSRRVQLQTVYNDAAYMTQHPRGSGRLYNCVVVDGSYIVFDPAAPKILLTRAEIEDLLRQEFNAARD… |
| A0A420RWW5 | 1058-1239 | None |
| A0A6A6BUJ5 | 256-433 | None |
| A0A1G0HAC0 | 92-246 | None |
| A0A094KMS8 | 1-205 | None |
| A0A328R0A0 | 240-401 | None |
| A0A2H9SF00 | 179-356 | None |
| A0A1G0GFN5 | 223-383 | None |
| A0A2H3FNW5 | 512-687 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.