DPCstruct | MC40496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3Z3H6 | 1-121 | MRFDDWDILLFPRDCKVPVKEFKVACHAIHDTEFFNSHGSFGLPTVCGFIPSLAAGTPFQISIHSWSAPSVSQFTRCYSKYGECANF… |
| K9G7L2 | 1-113 | MRYRNWDVLLFPEGSKVPIQEFKTQCFVTKDKDSPCLHSAIFLGHHAHHPEPGLFNQLPVLTTFIPSMPKDSPFQVSVHSWEKPRPS… |
| A0A2S7QYH7 | 1-118 | None |
| A0A4U0XRB0 | 1-124 | None |
| A1D9A2 | 1-123 | None |
| J5JTE0 | 1-121 | None |
| G0RXU4 | 214-341 | None |
| A0A6A6A8F6 | 29-152 | None |
| A0A6A5V3Z7 | 1-141 | None |
| A0A2S7NMX9 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.