DPCstruct | MC40495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 450 ± 86 aa |
| Standard deviation of domain lengths | 85.78 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.54 |
| Pfam Score | 82.34 |
| Assigned Pfam label(s) | CL0023- PF21516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9G1K6 | 1-499 | MLSTEVHDLSAEQSDAIEEAVPPQPIQDGAFPDEAVDPETNFLGSTGRITEVCDRCHDLIHHNKAVSSPKPTILSIRHYLEESPYKN… |
| A0A7X6YYJ4 | 1-275 | INKYDLLPKSLKEDKIKYWCSKKLNQLGIKYVDMVLISTRNKKNTDGLFQRIYNHANHKNIYVIGNANVGKSSLINILLEQYDNETN… |
| A0A4V1IS58 | 174-578 | None |
| L8HIZ2 | 22-435 | None |
| A0A7S0DT23 | 1-323 | None |
| A0A813FL94 | 61-498 | None |
| A0A086TH64 | 83-640 | None |
| A0A1D5B4I9 | 297-672 | None |
| G0MZA8 | 1-467 | None |
| A0A0X3PUL4 | 2-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.