DPCstruct | MC4049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P2DBN6 | 55-161 | FWFLLIALVVVVAAVTLAVIGGGEEAVLAEAAPEQVADGLPEHRAVAAADVDALRLPVAVRGYRMAEVDEALARLAAELAGRDERIA… |
| A0A810N1W7 | 1-138 | MGQFLLLLVVALTVGAVVFGVTVLVSGGDQGLAPAEPDGRAVPLPGTRPLIEGDVAEVRFDTALRGYRMEQVDQALHRAAYDIGYKD… |
| A0LW00 | 29-146 | None |
| A0A4Q7WJE3 | 1-146 | None |
| A0A4R0KK81 | 11-133 | None |
| A0A7Z0C495 | 2-88 | None |
| A0A7K0NVJ6 | 67-182 | None |
| A0A370H935 | 9-104 | None |
| A0A2S5J2W4 | 24-104 | None |
| A0A223RV74 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.