DPCstruct | MC40483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 175 ± 31 aa |
| Standard deviation of domain lengths | 30.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0BQL4 | 1-111 | MVISDVLFSQALRKYPQFWGLNNERISWKKNGKILADELTVTTNTTITVEDVCLKHNRIRESLVRLNKKPKEKRRTRLVAYLWYAIE… |
| A0A1A9ZWD4 | 1-191 | MNNVPNGLFSRLLMKYPKLWGINSEWVNWDVDAKQLAATLTEKSGHLITTKDVRNKVRAIKLALNRLNRLDQKKTRPLTLQAFLWYA… |
| A0A1B0C6U8 | 27-155 | None |
| A0A1B0BWP4 | 18-236 | None |
| A0A1A9UER5 | 5-196 | None |
| A0A1B0BXG1 | 1-220 | None |
| A0A1A9UMD3 | 6-190 | None |
| A0A1A9ZV24 | 1-162 | None |
| A0A1B0AVG3 | 328-475 | None |
| A0A1A9Z0D6 | 6-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.