DPCstruct | MC40477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 624 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 99.41 |
| Assigned Pfam label(s) | CL0220- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0WC75 | 540-609 | DACDWVCGDPDADGRINILDITYIVSYLYKGGSAPDPIESADVNGSGSINILDVTYIVNYLYKGGPEPDC |
| A0A2R2JFJ7 | 2-65 | PGDVDGNGSINSIDFALMRNYLLGNLKDFPAEDDIKAGDLNGDKSININDFAIMRMYLLGMITK |
| A0A2D8N049 | 396-482 | None |
| A0A2D8N044 | 349-441 | None |
| A0A2D8MWJ4 | 50-145 | None |
| A0A2D8N0W1 | 1122-1213 | None |
| A0A2D8MX19 | 8-88 | None |
| A0A2D8N1P9 | 32-124 | None |
| B8I4T1 | 375-448 | None |
| A0A1E3C487 | 478-546 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.