DPCstruct | MC40475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 233 |
|---|---|
| Mean domain length (aa) | 258 ± 61 aa |
| Standard deviation of domain lengths | 61.28 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 16.86 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0471- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I7LRE2 | 10-265 | LKAGFPALAGIPDIKSSVLKFLPRGIIGMKTNCLARKFNSTPPELTEALSDMISISGTSRKNIIIWERTERELEWGGFPVNRADSEI… |
| A0A101F9F7 | 5-199 | LEGNPLTEEKIKEGLAKLVSDLERVKKVLVVHTDYTRVDFTHLIAKNLYRLLLEKGMEEFHTLNASGTHRAMKIEEFEKKLGISRNE… |
| A0A7J3CVE5 | 27-303 | None |
| A0A1V5IF62 | 51-453 | None |
| A0A160V714 | 7-201 | None |
| A0A3C1VEN5 | 105-416 | None |
| A0A1F8LBN2 | 99-295 | None |
| A0A534ZJ90 | 145-441 | None |
| A0A2J6I950 | 133-452 | None |
| A0A359LW74 | 169-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.