DPCstruct | MC40472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 199 |
|---|---|
| Mean domain length (aa) | 160 ± 28 aa |
| Standard deviation of domain lengths | 28.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7WWW3 | 6-157 | WRAMVRKDLLLFFTDRRAVIMSFAAPVAIASFFGFIFSGNQSAKTARVPVRVVDQDGSVISKAIVQGLTTDQTLELTGGTAEEAREA… |
| A0A4S9BU72 | 2-153 | VDYDHGSIGHSLRSAATSLRADTFPSVDEHSTTDYAKVSDIRHAVLVGEFWAAIYSNPGASNRLNEALRSNDTAAEYNANDALTFVY… |
| A0A7R9KVQ1 | 109-287 | None |
| A0A7R9KTT4 | 424-570 | None |
| A0A124FWI7 | 1-136 | None |
| A0A0R1TT31 | 1-157 | None |
| A0A1D2MUQ8 | 236-403 | None |
| A0A380JUB7 | 15-133 | None |
| A0A7Y8VQI2 | 38-208 | None |
| A0A377DBS8 | 66-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.