DPCstruct | MC40468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U1P9Q4 | 35-171 | GVVFLLLGALLLVRGRGELRRLAFAGLIGTAAAGTLFSLTLYPAGFDLAPTARLLAHAEAQGRAIGNLGLYEGQYHWLGRLTRPIDR… |
| A0A2V7WM98 | 2-110 | CAVVAVVAIQWSIARAAAGTYDVEDIGRHLNRLQREGHPLSHVGRYSGEYQFAGRLDCSIDVIDSNAVSRWFARHPDGYVIAYTRRS… |
| A0A1J0VE34 | 19-123 | None |
| A0A847YAQ2 | 303-420 | None |
| A0A2W5FP08 | 6-110 | None |
| A0A1S1NLI7 | 244-346 | None |
| I4VIE5 | 86-194 | None |
| A0A1M5DN22 | 262-351 | None |
| W7WKU6 | 21-133 | None |
| A0A528C6L9 | 25-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.