DPCstruct | MC40463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 399 ± 115 aa |
| Standard deviation of domain lengths | 115.32 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 88.31 |
| Assigned Pfam label(s) | PF02142- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837HJ27 | 1-419 | MYPLKEEIAKSDCTPESVIEKTDIGGPTILRSAAKGQRIVMCDPTDRTVVIEWLKAGKPEREAFITSLVAKAEATVADYCLASAVYH… |
| A0A4W5KBN1 | 52-391 | AQYDEAISDYFRGQYSRGVSQLPLRYGMNPHQAPAQLYTLRPTLPLTVVNGSPGFINLCDALNAWQLVRELKRALGMPAATSFKHVS… |
| A0A7V1K4M8 | 3-368 | None |
| S9S8F7 | 44-397 | None |
| A0A4S4EWH4 | 139-573 | None |
| A0A176K144 | 3-422 | None |
| A0A507FSQ1 | 65-619 | None |
| A0A2K5ZA66 | 24-405 | None |
| A0A367LM89 | 42-595 | None |
| A0A7V5U340 | 1-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.