DPCstruct | MC40462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 229 ± 33 aa |
| Standard deviation of domain lengths | 33.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837HG82 | 11-235 | IEEFGDVYPAEEIKKDRERVEYIKKGKDYKEPTDDSIVLENMFTDLVEKYNWFGEGVKVVQLSEFDDKIASGAHCDVILEIPTGEDG… |
| A0A1F7WAJ2 | 44-298 | TETDVIDPKDFEDIVDPNIMRAHAQEVAYLRGIFDRQKEHPETAEVHMLGKILEAIVIEQIELNEWLGANVNTQQTCEFDDYCNGID… |
| A0A1F6EHH3 | 22-236 | None |
| A0A1F8GFJ6 | 2-240 | None |
| A0A2M7RIM5 | 59-291 | None |
| A0A7C4NGR7 | 34-247 | None |
| A0A2H0CU01 | 8-208 | None |
| A0A0G1FMR9 | 7-184 | None |
| A0A7V3LEL3 | 45-323 | None |
| A0A554LAA4 | 23-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.