DPCstruct | MC4046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 128 ± 26 aa |
| Standard deviation of domain lengths | 26.45 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 98.59 |
| Assigned Pfam label(s) | CL0286- PF02807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YVF8 | 127-265 | TGRSIRGISLPPHCSRAERRAVETISLDALSHLTGEFAGKYYPLSGMTDAEQEQLIADHFLFDKPVSPLLTCAGMARDWPDARGIWH… |
| A0A7S0FWZ2 | 377-503 | HLKASWDLQGLRAAGKMCADERCEAERVITNALSELTGSLEGEYLPLATSTSYPARPGGMSEMERQVLNAHGLLLQANGASGRGVFV… |
| A0A553N4L7 | 181-266 | None |
| A0A1D2MVW0 | 344-466 | None |
| A0A7S4PGS4 | 164-301 | None |
| A0A6P8HWY1 | 145-274 | None |
| A0A2G8LKB0 | 191-309 | None |
| T1GFR8 | 17-134 | None |
| A0A1Q9C880 | 74-228 | None |
| A0A086KW13 | 107-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.