DPCstruct | MC40449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 59 ± 2 aa |
| Standard deviation of domain lengths | 2.14 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 81.75 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0492- PF08071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6B4I6 | 1-60 | MARGPKHHLKRLTAPHHWMLDKLGGVFAPRPTSGPHKLRESLPLILFLRNRLKYALTYTE |
| W5PHJ8 | 1-59 | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPYKLRECLPIIFLRNRLKYALTGDE |
| A0A0B1TCB0 | 1-60 | None |
| A0A674BQ22 | 1-57 | None |
| A0A0A0KP69 | 1-61 | None |
| A0A1D6M1I2 | 86-142 | None |
| A0A3M0JB68 | 344-400 | None |
| A0A803PWV8 | 1-60 | None |
| A0A1E4SSI4 | 3-55 | None |
| A0A673UMI0 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.